PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009615029.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 334aa    MW: 37608.1 Da    PI: 8.1978
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009615029.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1805.9e-56141411128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeel+++yL kkv + ++++ ++i+evd++k+ePw+Lp k+k +ekewyfFs rd+ky+tg r+nrat++gyWkatgkd+e++s+
  XP_009615029.1  14 LPPGFRFHPTDEELITYYLLKKVLDGNFTA-RAIAEVDLNKCEPWELPGKAKMGEKEWYFFSLRDRKYPTGLRTNRATEAGYWKATGKDREIYSS 107
                     79*************************999.89***************99999****************************************97 PP

             NAM  96 .kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      + +lvg+kktLvfy+grapkgek++Wvmheyrl
  XP_009615029.1 108 kTCALVGMKKTLVFYRGRAPKGEKSNWVMHEYRL 141
                     45567***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.26E-6313166IPR003441NAC domain
PROSITE profilePS5100560.19714166IPR003441NAC domain
PfamPF023656.6E-2915141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010072Biological Processprimary shoot apical meristem specification
GO:0010160Biological Processformation of organ boundary
GO:0010223Biological Processsecondary shoot formation
GO:0048366Biological Processleaf development
GO:0048504Biological Processregulation of timing of organ formation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MENYQHYDCS DGNLPPGFRF HPTDEELITY YLLKKVLDGN FTARAIAEVD LNKCEPWELP  60
GKAKMGEKEW YFFSLRDRKY PTGLRTNRAT EAGYWKATGK DREIYSSKTC ALVGMKKTLV  120
FYRGRAPKGE KSNWVMHEYR LDGKFAYHYI SRSSKDEWVI SRVFQKNGST VGGNSNGGKK  180
RLSSSINLYQ EVSSPSSVSQ LPPLLDSSPY SNTATSAVIN ADRESFQKEH VPCFSTTATH  240
SFDPSSVFDI SSNSLHALPA PNFSAILDSS TNFTHYTRNS TFPSLRSLHE NLQLPLFSSG  300
APAMHGGFSA SMANWPVPET QKVEQSELDC MWSY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A7e-531316916168NO APICAL MERISTEM PROTEIN
1ut4_B7e-531316916168NO APICAL MERISTEM PROTEIN
1ut7_A7e-531316916168NO APICAL MERISTEM PROTEIN
1ut7_B7e-531316916168NO APICAL MERISTEM PROTEIN
3swm_A8e-531316919171NAC domain-containing protein 19
3swm_B8e-531316919171NAC domain-containing protein 19
3swm_C8e-531316919171NAC domain-containing protein 19
3swm_D8e-531316919171NAC domain-containing protein 19
3swp_A8e-531316919171NAC domain-containing protein 19
3swp_B8e-531316919171NAC domain-containing protein 19
3swp_C8e-531316919171NAC domain-containing protein 19
3swp_D8e-531316919171NAC domain-containing protein 19
4dul_A7e-531316916168NAC domain-containing protein 19
4dul_B7e-531316916168NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00562DAPTransfer from AT5G53950Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankX922050.0X92205.2 P.hybrida mRNA encoding NAM protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009615029.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 2
SwissprotO040171e-115NAC98_ARATH; Protein CUP-SHAPED COTYLEDON 2
TrEMBLB8XS010.0B8XS01_SOLLC; Goblet
STRINGSolyc07g062840.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15224279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53950.11e-106NAC family protein